PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400043024
Common NameLOC102602867
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family MYB
Protein Properties Length: 303aa    MW: 34959.5 Da    PI: 9.8693
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400043024genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.71.3e-181863147
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
       Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                          rg W + Ede+l ++v+q+G+ +W++Ia++++ gR++k+c++rw++ 
  PGSC0003DMP400043024 18 RGHWRPAEDERLRQLVEQYGPQNWNSIAEKLQ-GRSGKSCRLRWFNQ 63
                          899*****************************.***********996 PP

2Myb_DNA-binding54.42.9e-1770114147
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                           r +++++E+e+l+ a++ +G++ W++I+r ++ gRt++ +k++w+ +
  PGSC0003DMP400043024  70 RRPFSEDEEERLIGAHRIHGNK-WALISRLFP-GRTDNAVKNHWHVL 114
                           679*******************.*********.***********987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129426.5791368IPR017930Myb domain
SMARTSM007176.2E-151766IPR001005SANT/Myb domain
SuperFamilySSF466896.36E-2917111IPR009057Homeodomain-like
PfamPF002491.4E-171863IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-261971IPR009057Homeodomain-like
CDDcd001673.80E-132162No hitNo description
SMARTSM007176.0E-1469117IPR001005SANT/Myb domain
PROSITE profilePS5129421.81669119IPR017930Myb domain
PfamPF002492.5E-1470114IPR001005SANT/Myb domain
CDDcd001673.64E-1072115No hitNo description
Gene3DG3DSA:1.10.10.605.7E-2072118IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 303 aa     Download sequence    Send to blast
MAEGGGSGDD TIRSSCQRGH WRPAEDERLR QLVEQYGPQN WNSIAEKLQG RSGKSCRLRW  60
FNQLDPRINR RPFSEDEEER LIGAHRIHGN KWALISRLFP GRTDNAVKNH WHVLMARKQR  120
EQSKICGKRS LYQQQQQQHD NFDSKSSCYG FRRRNNNNNN NNNNTRIQEG NYGSKINFFE  180
FQNPNKDRVF SMSTTYSSEF CGSHLFRESS IDQKSLCQNN LSFSSHGRGG GGGDNNCKRS  240
TTFQNPFSYA DRNERVVNIS HSTFSFGKIL RENIEQQQKY GEEAREKKDI PFIDFLGVGI  300
SS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1msf_C2e-30181184104C-Myb DNA-Binding Domain
1mse_C2e-30181184104C-Myb DNA-Binding Domain
1gv2_A2e-30181184104MYB PROTO-ONCOGENE PROTEIN
1h89_C8e-301811858158MYB PROTO-ONCOGENE PROTEIN
1h88_C8e-301811858158MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754430.0HG975443.1 Solanum pennellii chromosome ch04, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006356314.10.0PREDICTED: transcription factor WER-like
TrEMBLM1CBE00.0M1CBE0_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000638620.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA17842466
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G17950.12e-65myb domain protein 52
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]